.
The Open Protein Structure Annotation Network
PDB Keyword
.

proteinMockup

    Table of contents
    No headers

    Site JCSG
    Status Crystallized
    Target Id 282160
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TM0284 Molecular Weight 56747.19 Da.
    Residues 506 Isoelectric Point 5.31
    Sequence myligsdigtqgtksvivnekgevlaeafreyevitpkpnwaeqwpdvwvkavfetvkevveksgvskke iagiaisglyggsgipvdrnmqplrpcliwmdrravketewvkqnvpkeklfeitgnyvdsyfgftkim wirnnepeiwekiykfitpkdyviyqmtgevvidyssagnlggvfdirkltwskemcdvlgipieflpe rivkssdvvgrvtkeaselcgllegtpvvaggidapvaqlsagaleegehvamvgtstcwgtvhdgskl afglvnypyvvydteriytfggsattgalarwfkeqfgesetivgertgispyqlfdkevanipagseg iivlpyfmgerspiwdptargvffgvtlyhkrahlyralmeggayalrhnmeeglkaglklndecwivg gvskssvwvkifadvtgfkmrqvaslveapygdaflaglgtgvidkperikewvkyrdpvepdpenkki ydryyeiyrelyertkdlmarl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0284

    Name: L-ribulokinase (L-ribulose) (reversible)
    Metabolic Subsystem: Arabinose Metabolism
    Reaction: : atp + rbl-L <==> adp + h + ru5p-L
    Classification: EC:2.7.1.16
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0284
    generated 12/2008

    Structure Description

    Discussion

     

     

    Function Description

    Discussion

     

     

    Evolutionary Context Desciption

    Discussion

     

     

    Regulation Description

    Discussion

     

     
     

     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch