The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and thermodynamic characterization of the EphB4/Ephrin-B2 antagonist peptide complex reveals the determinants for receptor specificity. Structure 14 321-330 2006
    Site ATCG3D
    PDB Id 2bba Target Id ATCG3D_13
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11889,AAL14194 Molecular Weight 21055.88 Da.
    Residues 185 Isoelectric Point 6.86
    Sequence hhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtgwvpr rgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyikvdtvaaehltrk rpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.19135
    Matthews' coefficent 3.09 Rfactor 0.17436
    Waters 223 Solvent Content 60.20

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch