.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hle

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity. J.Biol.Chem. 281 28185-28192 2006
    Site ATCG3D
    PDB Id 2hle Target Id ATCG3D_14
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11891, Molecular Weight 21321.14 Da.
    Residues 188 Isoelectric Point 6.91
    Sequence aghhhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtgw vprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyikvdtvaaehl trkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.29521
    Matthews' coefficent 2.25 Rfactor 0.22567
    Waters 79 Solvent Content 45.42

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch