.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qbx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of the EphB2 receptor in complex with an antagonistic peptide reveals a novel mode of inhibition. J.Biol.Chem. 282 36505-36513 2007
    Site ATCG3D
    PDB Id 2qbx Target Id ATCG3D_15
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11892,CAI22647 Molecular Weight 20223.71 Da.
    Residues 176 Isoelectric Point 5.42
    Sequence eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfirrrgahrihv emkfsvrdcssipsvpgscketfnlyyyeadfdsatktfpnwmenpwvkvdtiaadesfsqvdlggrvm kintevrsfgpvsrsgfylafqdyggcmsliavrvfyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2695
    Matthews' coefficent 2.18 Rfactor 0.19424
    Waters 174 Solvent Content 43.46

    Ligand Information
    Ligands SER-ASN-GLU-TRP-ILE-GLN-PRO-ARG-LEU (SULFATE) x 1;SO4 x 12
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch