.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rho

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Combined protein construct and synthetic gene engineering for heterologous protein expression and crystallization using Gene Composer. BMC Biotechnol. 9 37-37 2009
    Site ATCG3D
    PDB Id 2rho Target Id ATCG3D_187
    Related PDB Ids 2rhh 2rhj 2rhl 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS24443,ABQ96888 Molecular Weight 34017.99 Da.
    Residues 325 Isoelectric Point 4.92
    Sequence masikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglgaganpevgk kaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgvvtrpftfegrkrqlqaa ggisamkeavdtlivipndrileivdkntpmleafreadnvlrqgvqgisdliatpglinldfadvkti msnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggtnlslyevqeaadivasas dqdvnmifgsvinenlkdeivvtviatgfienlyfqghhhhhheympme
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.45 Rfree 0.270
    Matthews' coefficent 3.95 Rfactor 0.227
    Waters 99 Solvent Content 68.90

    Ligand Information
    Ligands GSP (5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE) x 1;GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch