.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bji

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of guanine nucleotide exchange mediated by the T-cell essential Vav1. J.Mol.Biol. 380 828-843 2008
    Site ATCG3D
    PDB Id 3bji Target Id ATCG3D_16
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11893, Molecular Weight 44359.70 Da.
    Residues 377 Isoelectric Point 8.32
    Sequence mteydkrccclreiqqteekytdtlgsiqqhflkplqrflkpqdieiifiniedllrvhthflkemkea lgtpgaanlyqvfikykerflvygrycsqvesaskhldrvaaaredvqmkleecsqranngrftlrdll mvpmqrvlkyhlllqelvkhtqeamekenlrlaldamrdlaqcvnevkrdnetlrqitnfqlsienldq slahygrpkidgelkitsverrskmdryaflldkallickrrgdsydlkdfvnlhsfqvrddssgdrdn kkwshmflliedqgaqgyelffktrelkkkwmeqfemaisniypenatanghdfqmfsfeettsckacq mllrgtfyqgyrchrcrasahkeclgrvppcg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.29253
    Matthews' coefficent 2.57 Rfactor 0.2211
    Waters 60 Solvent Content 52.21

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch