.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bl7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title DcpS as a therapeutic target for spinal muscular atrophy. Acs Chem.Biol. 3 711-722 2008
    Site ATCG3D
    PDB Id 3bl7 Target Id ATCG3D_188
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS24445,NP_054745 Molecular Weight 45953.79 Da.
    Residues 397 Isoelectric Point 6.12
    Sequence mshhhhhhsgevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgir iqadqtpedldmedndiieahreqiggsapvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdge davvilektpfqveqvaqlltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqd lrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddl yliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgf eapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.31 Rfree 0.27605
    Matthews' coefficent 2.05 Rfactor 0.21071
    Waters 211 Solvent Content 39.88

    Ligand Information
    Ligands DD1 (5-{[1-(2-FLUOROBENZYL)PIPERIDIN-4-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch