The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Specific Cholesterol Binding Site Is Established by the 2.8 A Structure of the Human beta(2)-Adrenergic Receptor. Structure 16 897-905 2008
    Site ATCG3D
    PDB Id 3d4s Target Id ATCG3D_18
    Molecular Characteristics
    Source Bacteriophage t4
    Alias Ids TPS11895,P07550 Molecular Weight 55890.18 Da.
    Residues 490 Isoelectric Point 8.90
    Sequence dykddddamgqpgngsafllapnrshapdhdvtqqrdevwvvgmgivmslivlaivfgnvlvitaiakf erlqtvtnyfitslacadlvmglavvpfgaahilmkmwtfgnfwcefwtsidvlcvtasiwtlcviavd ryfaitspfkyqslltknkarviilmvwivsgltsflpiqmhwyrathqeaincyaeetccdfftnqay aiassivsfyvplvimvfvysrvfqeakrqlnifemlrideglrlkiykdtegyytigighlltkspsl naakseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmge tgvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaykfclkehkalktlgii mgtftlcwlpffivnivhviqdnlirkevyillnwigyvnsgfnpliycrspdfriafqellclrrssl khhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.2725
    Matthews' coefficent 2.34 Rfactor 0.2300
    Waters 20 Solvent Content 47.36

    Ligand Information
    Ligands TIM ((2S)-1-(TERT-BUTYLAMINO)-3-[(4-MORPHOLIN-4-YL-1,2,5-) x 1;CLR (CHOLESTEROL) x 2;OLC ((2R)-2,3-DIHYDROXYPROPYL) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch