.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j2r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of escherichia coli gene product Yecd at 1.3 A resolution. To be published
    Site BIGS
    PDB Id 1j2r Target Id ASG-yecD
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11901, Molecular Weight 20451.08 Da.
    Residues 188 Isoelectric Point 5.37
    Sequence mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsadyaealkqp vdapspakvlpenwwqhpaalgatdsdieiikrqwgafygtdlelqlrrrgidtivlcgistnigvest arnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsveeilnal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.30 Rfree 0.16494
    Matthews' coefficent 2.03 Rfactor 0.14499
    Waters 924 Solvent Content 39.06

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 12
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch