.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uqw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Ylib Protein from E.Coli. To be Published
    Site BIGS
    PDB Id 1uqw Target Id ASG-yliB
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS11903, Molecular Weight 56467.20 Da.
    Residues 512 Isoelectric Point 8.22
    Sequence maravhrsglvalgiatalmascafaakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkem klknvlaesytvsddgitytvklregikfqdgtdfnaaavkanldrasdpanhlkrynlykniakteai dpttvkitlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfagy wqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmaspsimqryismnvt qkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsykpwpydpvkarellkeagypn gfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamdagqraaevegkgqkesgvrmfytgwsastg eadwalsplfasqnwpptlfntafysnkqvddflaqalktndpaektrlykaaqdiiwqespwiplvve klvsahsknltgfwimpdtgfsfedadlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.72 Rfree 0.256
    Matthews' coefficent 2.58 Rfactor 0.199
    Waters 309 Solvent Content 52

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals ZN (ZINC) x 12

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch