.
The Open Protein Structure Annotation Network
PDB Keyword
.

1eke

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of archaeal RNase HII: a homologue of human major RNase H. Structure 8 897-904 2000
    Site BSGC
    PDB Id 1eke Target Id BSGCAIR30321
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8323, Molecular Weight 26504.36 Da.
    Residues 230 Isoelectric Point 8.49
    Sequence miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlgyvekrilea eeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfedsfkdkiediikernl nikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsgypsdpktikfledyfkkhkklpdi arthwktckrildkskqtkliie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.262
    Matthews' coefficent 2.36 Rfactor 0.21
    Waters 313 Solvent Content 48.00

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch