.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ilw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure and mechanism of catalysis of a pyrazinamidase from Pyrococcus horikoshii. Biochemistry 40 14166-14172 2001
    Site BSGC
    PDB Id 1ilw Target Id BSGCAIR30510
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS8688, Molecular Weight 20191.17 Da.
    Residues 180 Isoelectric Point 5.67
    Sequence mpeealivvdmqrdfmpggalpvpegdkiipkvneyirkfkekgalivatrdwhpenhisfrerggpwp rhcvqntpgaefvvdlpedaviiskatepdkeaysgfegtdlakilrgngvkrvyicgvateycvrata ldalkhgfevyllrdavkgikpedeeraleemksrgikivqf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.257
    Matthews' coefficent 1.94 Rfactor 0.1814
    Waters 88 Solvent Content 36.46

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch