The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MJ1247 protein from M. jannaschii at 2.0 A resolution infers a molecular function of 3-hexulose-6-phosphate isomerase. Structure 10 195-204 2002
    Site BSGC
    PDB Id 1jeo Target Id BSGCAIR30509
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8687, Molecular Weight 20441.95 Da.
    Residues 180 Isoelectric Point 8.28
    Sequence mskleeldivsnnililkkfytndewknkldslidriikakkififgvgrsgyigrcfamrlmhlgfks yfvgetttpsyekddllilisgsgrtesvltvakkakninnniiaivcecgnvvefadltiplevkksk ylpmgttfeetalifldlviaeimkrlnldeseiikrhcnll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2265000
    Matthews' coefficent 2.33 Rfactor 0.1891000
    Waters 72 Solvent Content 47.20

    Ligand Information
    Ligands CIT (CITRIC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch