The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein from Escherichia coli. J.STRUCT.FUNCT.GENOM. 2 53-66 2002
    Site BSGC
    PDB Id 1jx7 Target Id BSGCAIR30513
    Molecular Characteristics
    Source Escherichia coli o157:h7
    Alias Ids TPS8691, Molecular Weight 12692.04 Da.
    Residues 117 Isoelectric Point 5.02
    Sequence mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyniqqmleilt aqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.2650000
    Matthews' coefficent 2.42 Rfactor 0.2290000
    Waters 86 Solvent Content 49.20

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch