.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lfp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein Aq1575 from Aquifex aeolicus. Proc.Natl.Acad.Sci.USA 99 7980-7985 2002
    Site BSGC
    PDB Id 1lfp Target Id BSGCAIR30373
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS8330, Molecular Weight 27861.35 Da.
    Residues 249 Isoelectric Point 5.20
    Sequence maghshwaqikhkkakvdaqrgklfsklireiivatrlggpnpefnprlrtaieqakkanmpweniera ikkgagelegeqfeeviyegyapggvavmvlattdnrnrttsevrhvftkhggnlgasgcvsylferkg yievpakevseeellekaievgaedvqpgeevhiiytvpeelyevkenleklgvpiekaqitwkpistv qindeetaqkvikllnaleelddvqqvianfeipeeilqkvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.294
    Matthews' coefficent 1.88 Rfactor 0.228
    Waters 350 Solvent Content 34.63

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch