The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a flavin-binding protein from Thermotoga Maritima. Proteins 52 633-635 2003
    Site BSGC
    PDB Id 1mrz Target Id BSGCAIR30409
    Related PDB Ids 1s4m 1t6x 1t6y 1t6z 2i1l 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8618, Molecular Weight 33612.10 Da.
    Residues 293 Isoelectric Point 8.77
    Sequence mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrvemlsryart vvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgvevyeiedvvvqgkrvsss lirnlvqegrveeipaylgryfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdg kkkfgvmnvgfrptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvks arnmiddiinskfekeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23347
    Matthews' coefficent 2.51 Rfactor 0.21696
    Waters 442 Solvent Content 50.54

    Ligand Information
    Ligands CIT (CITRIC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch