.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nye

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of OsmC from Escherichia coli: a salt-shock-induced protein. Acta Crystallogr.,Sect.D 60 903-911 2004
    Site BSGC
    PDB Id 1nye Target Id BSGCAIR30339
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8325, Molecular Weight 15087.31 Da.
    Residues 143 Isoelectric Point 5.57
    Sequence mtihkkgqahwegdikrgkgtvstesgvlnqqpygfntrfegekgtnpeeligaahaacfsmalslmlg eagftptsidttadvsldkvdagfaitkialksevavpgidastfdgiiqkakagcpvsqvlkaeitld yqlks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.277
    Matthews' coefficent 2.40 Rfactor 0.218
    Waters 87 Solvent Content 48.74

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch