The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-resolution structure of RNase P protein from Thermotoga maritima. Proc.Natl.Acad.Sci.USA 100 7497-7502 2003
    Site BSGC
    PDB Id 1nz0 Target Id BSGCAIR30512
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8690, Molecular Weight 14316.29 Da.
    Residues 117 Isoelectric Point 11.25
    Sequence mtesftrrerlrlrrdfllifkegkslqneyfvvlfrkngldysrlgivvkrkfgkatrrnklkrwvre ifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.20 Rfree 0.217
    Matthews' coefficent 2.28 Rfactor 0.1625
    Waters 533 Solvent Content 41.10

    Ligand Information
    Ligands SO4 (SULFATE) x 16



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch