.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oy5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tRNA (m1G37) methyltransferase from Aquifex aeolicus at 2.6 A resolution: a novel methyltransferase fold. Proteins 53 326-328 2003
    Site BSGC
    PDB Id 1oy5 Target Id BSGCAIR30419
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS8670, Molecular Weight 29650.05 Da.
    Residues 257 Isoelectric Point 6.62
    Sequence mssnplrffvltifphiiscyseygivkqaikkgkvevypidlrefapkgqvddvpygglpgmvlkpep iyeaydyvvenygkpfvlitepwgeklnqklvnelskkerimiicgryegvdervkkivdmeislgdfi lsggeivalavidavsrvlpgvlsepqsiqedsfqnrwlgypvytrpreyrgmkvpeellsghhkliel wklwhrientvkkrpdlipkdltelekdilnsilsgksfkewlkehkhll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.30029
    Matthews' coefficent 2.36 Rfactor 0.27937
    Waters 76 Solvent Content 47.89

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch