.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s3l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional characterization of a novel phosphodiesterase from Methanococcus jannaschii. J.Biol.Chem. 279 31854-31862 2004
    Site BSGC
    PDB Id 1s3l Target Id BSGCAIR30314
    Related PDB Ids 1s3m 1s3n 
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8284, Molecular Weight 19037.61 Da.
    Residues 166 Isoelectric Point 4.61
    Sequence mkigimsdthdhlpnirkaieifndenvetvihcgdfvslfvikefenlnaniiatygnndgercklke wlkdineeniiddfisveiddlkffithghhqsvlemaiksglydvviyghthervfeevddvlvinpg eccgyltgiptigildtekkeyreivle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.253
    Matthews' coefficent 2.99 Rfactor 0.226
    Waters 45 Solvent Content 58.82

    Ligand Information
    Ligands UNX (UNKNOWN) x 2;PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch