.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s4m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of flavin binding to FAD synthetase of Thermotoga maritima. Proteins 58 246-248 2005
    Site BSGC
    PDB Id 1s4m Target Id BSGCAIR30409
    Related PDB Ids 1mrz 1t6x 1t6y 1t6z 2i1l 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8636, Molecular Weight 33612.10 Da.
    Residues 293 Isoelectric Point 8.77
    Sequence mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrvemlsryart vvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgvevyeiedvvvqgkrvsss lirnlvqegrveeipaylgryfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdg kkkfgvmnvgfrptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvks arnmiddiinskfekeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2587
    Matthews' coefficent 2.41 Rfactor 0.212
    Waters 228 Solvent Content 48.91

    Ligand Information
    Ligands LUM (LUMICHROME) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch