.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s7d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of refined tetragonal crystal of YodA from Escherichia coli. TO BE PUBLISHED
    Site BSGC
    PDB Id 1s7d Target Id BSGCAIR30656
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8715, Molecular Weight 24760.63 Da.
    Residues 216 Isoelectric Point 5.91
    Sequence mairlyklavalgvfivsapafshghhshgkplteveqkaangvfddanvqnrtlsdwdgvwqsvypll qsgkldpvfqkkadadktktfaeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykilty ksgkkgvrylfeckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsse evveemmsh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.17 Rfree 0.255
    Matthews' coefficent 2.71 Rfactor 0.21
    Waters 83 Solvent Content 54.32

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch