.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sbq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution. Proteins 56 839-843 2004
    Site BSGC
    PDB Id 1sbq Target Id BSGCAIR30461
    Related PDB Ids 1u3f 1u3g 
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8677, Molecular Weight 19264.37 Da.
    Residues 164 Isoelectric Point 6.60
    Sequence mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvdfffeflkin qiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgkgyydrylmqltrqqpkig iaysfqkgdfladpwdvqldliinde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2699
    Matthews' coefficent 2.95 Rfactor 0.2391
    Waters 115 Solvent Content 57.92

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch