.
The Open Protein Structure Annotation Network
PDB Keyword
.

1shs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a small heat-shock protein. Nature 394 595-599 1998
    Site BSGC
    PDB Id 1shs Target Id BSGCAIR30505
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8683, Molecular Weight 16451.13 Da.
    Residues 147 Isoelectric Point 5.06
    Sequence mfgrdpfdslfermfkeffatpmtgttmiqsstgiqisgkgfmpisiiegdqhikviawlpgvnkedii lnavgdtleirakrsplmiteseriiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaes sikkginie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.90 Rfree 0.2510000
    Matthews' coefficent 2.20 Rfactor 0.2160000
    Waters Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch