The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Studies of the Nudix Hydrolase DR1025 From Deinococcus radiodurans and its Ligand Complexes. J.Mol.Biol. 339 103-116 2004
    Site BSGC
    PDB Id 1soi Target Id BSGCAIR30561
    Related PDB Ids 1sjy 1su2 1sz3 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8698, Molecular Weight 17568.04 Da.
    Residues 159 Isoelectric Point 5.01
    Sequence mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqdaavreacee tglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvsredfaqlyaagqirm yqtklfyadalrekgfpalpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.251
    Matthews' coefficent 2.45 Rfactor 0.218
    Waters 103 Solvent Content 49.77

    Ligand Information
    Metals SM (SAMARIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch