The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a heat-inducible transcriptional repressor HrcA from Thermotoga maritima: structural insight into DNA binding and dimerization. J.Mol.Biol. 350 987-996 2005
    Site BSGC
    PDB Id 1stz Target Id BSGCAIR30318
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8322, Molecular Weight 39304.43 Da.
    Residues 338 Isoelectric Point 9.24
    Sequence mrrlnrknnealkklndrqrkvlycivreyienkkpvssqrvlevsniefssatirndmkkleylgyiy qphtsagriptdkglrfyyeemlkisketseadlavetfksmpladpekvlflagnllarltegyvlie rpntrdlkilrvmlipvsedylifsiltefgvskvtpiktqerlnweeierqlnfllrgrtvgevlmgk ieslkgsgflrliesligetveryldaglenllkdetltledirnlleevkdqkfleslvgegitvrig reigrkklekfavfsgkyfkgespigsvylftskvtkydrnhrvfeyilnrlseyftstsrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.25753
    Matthews' coefficent 2.61 Rfactor 0.21494
    Waters 450 Solvent Content 52.78

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch