The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural characterization of an iron-sulfur cluster assembly protein IscU in a zinc-bound form. Proteins 59 875-881 2005
    Site BSGC
    PDB Id 1su0 Target Id BSGCAIR30592
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8703, Molecular Weight 17141.53 Da.
    Residues 159 Isoelectric Point 5.65
    Sequence malsklnhlymavvadhskrphhhgqldgveavqlnnptcgdvisltvkfdedkiediafagngctist asssmmtdavigkskeealaladifsemvqgqenpaqkelgeaellagvakfpqrikcstlawnalkea ikrsanaqhltdqnvkegknv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.25582
    Matthews' coefficent 2.13 Rfactor 0.21981
    Waters 22 Solvent Content 42.21

    Ligand Information
    Metals ZN (ZINC) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch