The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ScpB from Chlorobium tepidum, a protein involved in chromosome partitioning. Proteins 62 322-328 2006
    Site BSGC
    PDB Id 1t6s Target Id BSGCAIR30640
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS8713, Molecular Weight 23922.86 Da.
    Residues 209 Isoelectric Point 5.09
    Sequence mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfrihaiaggyr fltepefadlvrqllapviqrrlsrsmlevlavvawhqpvtkgeiqqirgaspdysidrllarglievr gradspgrplqygttevfldlfhlpslkdlpklreikeilqeheeqqylaadgdlpvaadedekprmerie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.2531
    Matthews' coefficent 2.19 Rfactor 0.2157
    Waters 98 Solvent Content 42.92

    Ligand Information
    Ligands NO3 (NITRATE) x 21



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch