The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ADP bound FAD synthetase. To be Published
    Site BSGC
    PDB Id 1t6y Target Id BSGCAIR30409
    Related PDB Ids 1mrz 1s4m 1t6x 1t6z 2i1l 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8662, Molecular Weight 33612.10 Da.
    Residues 293 Isoelectric Point 8.77
    Sequence mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrvemlsryart vvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgvevyeiedvvvqgkrvsss lirnlvqegrveeipaylgryfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdg kkkfgvmnvgfrptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvks arnmiddiinskfekeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.298
    Matthews' coefficent 2.50 Rfactor 0.231
    Waters 33 Solvent Content 50.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch