.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t70

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and enzymatic characterization of DR1281: A calcineurin-like phosphoesterase from Deinococcus radiodurans. Proteins 70 1000-1009 2008
    Site BSGC
    PDB Id 1t70 Target Id BSGCAIR30429
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8675, Molecular Weight 27934.07 Da.
    Residues 255 Isoelectric Point 5.82
    Sequence mrvlfigdvfgqpgrrvlqnhlptirpqfdfvivnmensaggfgmhrdaargaleagagcltlgnhawh hkdiypmlsedtypivrplnyadpgtpgvgwrtfdvngekltvvnllgrvfmeavdnpfrtmdallerd dlgtvfvdfhaeatsekeamgwhlagrvaavigththvptadtrilkggtayqtdagftgphdsiigsa iegplqrflterphrygvaegraelngvalhfeggkataaeryrfied
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.26
    Matthews' coefficent 2.67 Rfactor 0.207
    Waters 319 Solvent Content 91.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch