.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t71

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a novel phosphatase from Mycoplasma pneumoniae. To be Published
    Site BSGC
    PDB Id 1t71 Target Id BSGCAIR30460
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8676, Molecular Weight 31429.66 Da.
    Residues 281 Isoelectric Point 8.83
    Sequence mmnsikfiflgdvygkagrniiknnlaqlkskyqadlvivnaentthgkglslkhyeflkeagvnyitm gnhtwfqkldlavvinkkdlvrplnldtsfafhnlgqgslvfefnkakiritnllgtsvplpfkttnpf kvlkelilkrdcdlhivdfhaettseknafcmafdgyvttifgththvpsadlritpkgsayitdvgmc gpgfgsviganpeqsirlfcagsrehfevskcgaqlngvffevdvntkkvikteairiveddprylkqd yfnli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.247
    Matthews' coefficent 4.44 Rfactor 0.215
    Waters 219 Solvent Content 71.30

    Ligand Information
    Ligands
    Metals FE (FE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch