.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t75

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Escherichia coli beta carbonic anhydrase. TO BE PUBLISHED
    Site BSGC
    PDB Id 1t75 Target Id BSGCAIR31213
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8718, Molecular Weight 25095.51 Da.
    Residues 220 Isoelectric Point 6.16
    Sequence mkdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelfvhrnvanl vihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwllhirdiwfkhssllgemp qerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgwaygihdgllrdldvtatnretleqryrh gisnlklkhanhk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.24569
    Matthews' coefficent 2.47 Rfactor 0.19589
    Waters 194 Solvent Content 49.80

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch