The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of Gene Target gi3844938 from Mycoplasma genitalium. To be Published
    Site BSGC
    PDB Id 1tm9 Target Id BSGCAIR30548
    Molecular Characteristics
    Source Mycoplasma genitalium
    Alias Ids TPS8695, Molecular Weight 15702.90 Da.
    Residues 137 Isoelectric Point 4.85
    Sequence meqnnikeqlisffnqacsthqerldficstresdtfssvdvplepikniieitkdenqqieitkiavn niktlssvgatgqymasffstnsepaiifcviyflyhfgflkdnnkkqiikkayetiadniadylnen
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch