.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u0l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain. Proc.Natl.Acad.Sci.Usa 101 13198-13203 2004
    Site BSGC
    PDB Id 1u0l Target Id BSGCAIR31221
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8692, Molecular Weight 33639.92 Da.
    Residues 295 Isoelectric Point 5.70
    Sequence mnlrrrgivvsfhsnmvtvedeetgerilcklrgkfrlqnlkiyvgdrveytpdetgsgvienvlhrkn lltkphvanvdqvilvvtvkmpetstyiidkflvlaekneletvmvinkmdlydeddlrkvreleeiys glypivktsaktgmgieelkeylkgkistmaglsgvgkssllnainpglklrvsevseklqrgrhtttt aqllkfdfggyvvdtpgfanleindiepeelkhyfkefgdkqcffsdcnhvdepecgvkeavengeiae sryenyvkmfyellgrrkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.284
    Matthews' coefficent 3.01 Rfactor 0.218
    Waters 56 Solvent Content 57.60

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 3
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch