The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution. Proteins 56 839-843 2004
    Site BSGC
    PDB Id 1u3f Target Id BSGCAIR30461
    Related PDB Ids 1sbq 1u3g 
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8678, Molecular Weight 19264.37 Da.
    Residues 164 Isoelectric Point 6.60
    Sequence mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvdfffeflkin qiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgkgyydrylmqltrqqpkig iaysfqkgdfladpwdvqldliinde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.268
    Matthews' coefficent 2.19 Rfactor 0.223
    Waters 245 Solvent Content 43.30

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch