The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae (GI: 13508087) at 2.2 A resolution. Proteins 56 839-843 2004
    Site BSGC
    PDB Id 1u3g Target Id BSGCAIR30461
    Related PDB Ids 1sbq 1u3f 
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8679, Molecular Weight 19264.37 Da.
    Residues 164 Isoelectric Point 6.60
    Sequence mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvdfffeflkin qiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgkgyydrylmqltrqqpkig iaysfqkgdfladpwdvqldliinde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.269
    Matthews' coefficent 2.11 Rfactor 0.208
    Waters 81 Solvent Content 41.20

    Ligand Information
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch