The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum. J.Biol.Chem. 280 18326-18335 2005
    Site BSGC
    PDB Id 1yte Target Id BSGCAIR30619
    Related PDB Ids 1ytd 1ytk 2i1o 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS8709, Molecular Weight 43294.38 Da.
    Residues 392 Isoelectric Point 6.20
    Sequence mnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinftgldevlkllegldv dlyaipegtilfprdanglpvpfirvegrycdfgmyetailgficqasgistkaskvrlaagdspffsf girrmhpaispmidrsayiggadgvsgilgaklidqdpvgtmphalsimlgdeeawkltlentkngqks vllidtymdekfaaikiaemfdkvdyirldtpssrrgnfealirevrwelalrgrsdikimvsgglden tvkklreagaeafgvgtsissakpfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqe ktcicggsmqnllvkylshgkrtseyprpkeirsrsmkeleyfkdis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.254
    Matthews' coefficent 3.71 Rfactor 0.196
    Waters 76 Solvent Content 65.60

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch