.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zxj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the hypothetical Mycoplasma protein MPN555 suggests a chaperone function. Acta Crystallogr.,Sect.D 61 1343-1347 2005
    Site BSGC
    PDB Id 1zxj Target Id BSGCAIR30355
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8328, Molecular Weight 22432.63 Da.
    Residues 193 Isoelectric Point 5.58
    Sequence matnlkstaklvkpiqydevieverifadpafieqhrqrilasfkdakesalyhelthivikdnlfsca mnaivgyfefnideaelknvmeglkrdviqgaedntvqaiaekiikkalvfnhlqkewkveitdevvkn vislyyektnqsvreylddkqkfegvrtalleermvletinhfkfhfnltgqlpn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.322
    Matthews' coefficent 2.13 Rfactor 0.248
    Waters 14 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch