.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ba2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the DUF16 domain of MPN010 from Mycoplasma pneumoniae. Protein Sci. 15 921-928 2006
    Site BSGC
    PDB Id 2ba2 Target Id BSGCAIR30905
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8717, Molecular Weight 9775.71 Da.
    Residues 85 Isoelectric Point 6.78
    Sequence vktpgtryvthkqldeklknfvtktefkefqtvvmesfavqnqnidaqgeqikelqveqkaqgktlqli lealqginkrldnles
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.281
    Matthews' coefficent 1.91 Rfactor 0.229
    Waters 190 Solvent Content 33.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch