.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of O67745_AQUAE, a hypothetical protein from Aquifex aeolicus. Acta Crystallogr.,Sect.F 63 369-374 2007
    Site BSGC
    PDB Id 2hek Target Id BSGCAIR30544
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS8694, Molecular Weight 44114.43 Da.
    Residues 371 Isoelectric Point 6.35
    Sequence mikefsdplygfvrvgeaglrlidsfpfqrlryvkqlglaylvfpsaqhtrfehslgvyhitericesl kvkekelvklagllhdlghppfshttevllprershedfterviketeiyeilkqdyshedierlvrit lgkpedeeekllseiitgefgsdrmdylrrdayfcgvsygffdydrlistlrvyenkvvvdesglrale nflisryfmyvqvyfhkvvrilsihlveflkklisqedftdinnflrlndafviselfkrkafredfer ifqrkhfktllstenyekfsetkerllekfpqekvrfdevekevyggniyvlsseglkkahelsplias lkpiklyriyvdrqlwekarselkls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2201
    Matthews' coefficent 3.18 Rfactor 0.17455
    Waters 355 Solvent Content 61.34

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4;GDP (GUANOSINE-5'-DIPHOSPHATE) x 2;GOL (GLYCEROL) x 8
    Metals ZN (ZINC) x 2;CL (CHLORIDE) x 5;BR (BROMIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch