.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional activator of comK gene from Bacillus halodurans. Proteins 69 409-414 2007
    Site BSGC
    PDB Id 2hqb Target Id BSGCAIR31267
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8721, Molecular Weight 32292.17 Da.
    Residues 290 Isoelectric Point 4.42
    Sequence mvgllvedtiddqgwnrkayegllnihsnldvdvvleegvnseqkahrrikelvdggvnlifghghafa eyfstihnqypdvhfvsfngevkgenitslhfegyamgyfggmvaasmsethkvgviaafpwqpevegf vdgakymneseafvryvgewtdadkalelfqelqkeqvdvfypagdgyhvpvveaikdqgdfaigyvgd qadlggstiltstvqhvddlyvlvakrfqegklesgnlyydfqdgvvslgefssvvpdevreqitdais tyiqtgqfpheeer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.28
    Matthews' coefficent 4.32 Rfactor 0.237
    Waters 12 Solvent Content 71.56

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch