.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hql

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a novel single-stranded DNA binding protein from Mycoplasma pneumoniae. Proteins 67 776-782 2007
    Site BSGC
    PDB Id 2hql Target Id BSGCAIR30666
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8716, Molecular Weight 12468.96 Da.
    Residues 104 Isoelectric Point 8.95
    Sequence mlnrvflegeiesscwsvkktgflvtikqmrffgerlftdyyviyangqlayelekhtkkyktisiegi lrtylerkseiwkttieivkifnpkneividykei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.272
    Matthews' coefficent 2.62 Rfactor 0.21
    Waters 168 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch