.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hy5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DsrEFH. To be Published
    Site BSGC
    PDB Id 2hy5 Target Id BSGCAIR31216
    Related PDB Ids 2hyb 
    Molecular Characteristics
    Source Allochromatium vinosum
    Alias Ids TPS8719, Molecular Weight 11084.04 Da.
    Residues 102 Isoelectric Point 4.70
    Sequence msilhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyvlgpdlkar gfsdervipgisvvdyagfvdlttecdtvqawl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.211
    Matthews' coefficent 2.11 Rfactor 0.182
    Waters 347 Solvent Content 41.84

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch