.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hyb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hexameric DsrEFH. To be Published
    Site BSGC
    PDB Id 2hyb Target Id BSGCAIR31216
    Related PDB Ids 2hy5 
    Molecular Characteristics
    Source Allochromatium vinosum
    Alias Ids TPS8720, Molecular Weight 11084.04 Da.
    Residues 102 Isoelectric Point 4.70
    Sequence msilhtvnkspfernslesclkfategasvllfedgiyaalagtrvesqvtealgklklyvlgpdlkar gfsdervipgisvvdyagfvdlttecdtvqawl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.262
    Matthews' coefficent 2.22 Rfactor 0.206
    Waters 418 Solvent Content 44.67

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch