.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i15

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MPN423 from Mycoplasma pneumoniae. To be Published
    Site BSGC
    PDB Id 2i15 Target Id BSGCAIR30378
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8342, Molecular Weight 14938.35 Da.
    Residues 129 Isoelectric Point 4.82
    Sequence mkpqllalkqfvqtefekvdfetfrqnfnrclereqstlliyedddyddqsfflkpmlsdaffissevv kqldllavlvdnpkgdvksccqsfyealtlfisalaitkgvdvgryhqqlgkrfgvltvy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.291
    Matthews' coefficent 2.34 Rfactor 0.23
    Waters 74 Solvent Content 47.39

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch