.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i1o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a zinc ion bound Nicotinate Phosphoribosyltransferase from Thermoplasma acidophilum. To be Published
    Site BSGC
    PDB Id 2i1o Target Id BSGCAIR30619
    Related PDB Ids 1ytd 1yte 1ytk 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS8711, Molecular Weight 43294.38 Da.
    Residues 392 Isoelectric Point 6.20
    Sequence mnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinftgldevlkllegldv dlyaipegtilfprdanglpvpfirvegrycdfgmyetailgficqasgistkaskvrlaagdspffsf girrmhpaispmidrsayiggadgvsgilgaklidqdpvgtmphalsimlgdeeawkltlentkngqks vllidtymdekfaaikiaemfdkvdyirldtpssrrgnfealirevrwelalrgrsdikimvsgglden tvkklreagaeafgvgtsissakpfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqe ktcicggsmqnllvkylshgkrtseyprpkeirsrsmkeleyfkdis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.25
    Matthews' coefficent 3.65 Rfactor 0.208
    Waters 121 Solvent Content 66.30

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 2;ACY (ACETIC) x 2
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch