.
The Open Protein Structure Annotation Network
PDB Keyword
.

2mjp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based identification of a novel NTPase from Methanococcus jannaschii. Nat.Struct.Biol. 6 691-696 1999
    Site BSGC
    PDB Id 2mjp Target Id BSGCAIR30511
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8689, Molecular Weight 22201.35 Da.
    Residues 193 Isoelectric Point 5.50
    Sequence mqrtlgeimkiyfatgnpnkikeaniilkdlkdveieqikisypeiqgtleevaefgakwvynilkkpv ivedsgffvealngfpgtyskfvqetignegilkllegkdnrnayfktvigycdengvrlfkgivkgrv seeirskgygfaydsifipeeeertfaemtteeksqishrkkafeefkkflldri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2590000
    Matthews' coefficent 2.53 Rfactor 0.2040000
    Waters 161 Solvent Content 51.34

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch