.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fc5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Escherichia coli MoeA, a protein from the molybdopterin synthesis pathway. J.Mol.Biol. 310 419-431 2001
    Site BSGI
    PDB Id 1fc5 Target Id MOEA_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11943, Molecular Weight 44064.85 Da.
    Residues 411 Isoelectric Point 5.03
    Sequence mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrladia sgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrftaevrsgqnirr rgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstgdelqlpgqplgdgqiydtnrl avhlmleqlgcevinlgiirddphalraafieadsqadvvissggvsvgeadytktileelgeiafwkl aikpgkpfafgklsnswfcglpgnpvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgr ldfqrgvlqrnadgelevtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2970000
    Matthews' coefficent 2.27 Rfactor 0.2530000
    Waters 500 Solvent Content 45.76

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch