.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fg7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of histidinol phosphate aminotransferase (HisC) from Escherichia coli, and its covalent complex with pyridoxal-5'-phosphate and l-histidinol phosphate. J.Mol.Biol. 311 761-776 2001
    Site BSGI
    PDB Id 1fg7 Target Id HIS8_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11956, Molecular Weight 39357.94 Da.
    Residues 356 Isoelectric Point 5.01
    Sequence mstvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpkavienyaq yagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigvecrtvptldnwqldlq gisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivvadeayiefcpqaslagwlaeyphla ilrtlskafalaglrcgftlaneevinllmkviapyplstpvadiaaqalspqgivamrervaqiiaer eyliaalkeipcveqvfdsetnyilarfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesq rvidalraeqv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2190000
    Matthews' coefficent 2.29 Rfactor 0.2050000
    Waters 224 Solvent Content 46.35

    Ligand Information
    Ligands PMP (4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch