.
The Open Protein Structure Annotation Network
PDB Keyword
.

1gz0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of the Rlmb 23S Rrna Methyltransferase Reveals a New Methyltransferase Fold with a Unique Knot. Structure 10 1303 2002
    Site BSGI
    PDB Id 1gz0 Target Id RLMB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11976, Molecular Weight 26555.16 Da.
    Residues 243 Isoelectric Point 6.17
    Sequence msemiygihavqalleraperfqevfilkgredkrllplihalesqgvviqlanrqyldeksdgavhqg iiarvkpgrqyqendlpdliasldqpfllildgvtdphnlgaclrsadaagvhavivpkdrsaqlnata kkvacgaaesvplirvtnlartmrmlqeeniwivgtageadhtlyqskmtgrlalvmgaegegmrrltr ehcdelisipmagsvsslnvsvatgiclfeavrqrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.5 Rfree 0.279
    Matthews' coefficent 2.249 Rfactor 0.231
    Waters 177 Solvent Content 43

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch